Lineage for d4wb4a_ (4wb4 A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266366Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 2266367Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 2266374Protein automated matches [254616] (4 species)
    not a true protein
  7. 2266394Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries)
  8. 2266400Domain d4wb4a_: 4wb4 A: [260117]
    automated match to d2o1ja_
    complexed with ca

Details for d4wb4a_

PDB Entry: 4wb4 (more details), 2.03 Å

PDB Description: wt sa11 nsp4_ccd
PDB Compounds: (A:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d4wb4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wb4a_ h.1.13.1 (A:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]}
ekqmdrvvkemrrqlemidklttreieqvellkriydkltv

SCOPe Domain Coordinates for d4wb4a_:

Click to download the PDB-style file with coordinates for d4wb4a_.
(The format of our PDB-style files is described here.)

Timeline for d4wb4a_: