Lineage for d4w5ka_ (4w5k A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1868013Species Trypanosoma brucei [TaxId:999953] [260109] (1 PDB entry)
  8. 1868014Domain d4w5ka_: 4w5k A: [260110]
    automated match to d7aata_
    complexed with edo, mlt, plp; mutant

Details for d4w5ka_

PDB Entry: 4w5k (more details), 1.7 Å

PDB Description: structure of a mitochondrial aspartate aminotransferase from trypanosoma brucei, k237a mutant
PDB Compounds: (A:) Aspartate aminotransferase, mitochondrial

SCOPe Domain Sequences for d4w5ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w5ka_ c.67.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 999953]}
glgqdfrmdpakrkvnlsigvyrddadqpfvlecvkqatlgtnmdyapvtgiasfveeaq
klcfgptcaalrdgriascqtlggtgalriggdllnrfvancnriygpdvgypnhesifa
kagmeltpysyydpatkglnlagmlecldkapegsvilvhacahnptgvdpthddwrqvc
dvikrrnhipfvdmayqgfatgqldydafvprhlvdmvpnlivaqsfsanfglyghrcga
lhistasaeeakrlvsqlallirpmysnpplygawvvssilkdpqltalwkkelkqmssr
iaevrkrlvselkacgsvhdwshierqvgmmaytgltreqvellrseyhiymtlngraav
sglnstnveyvsqaihnvtk

SCOPe Domain Coordinates for d4w5ka_:

Click to download the PDB-style file with coordinates for d4w5ka_.
(The format of our PDB-style files is described here.)

Timeline for d4w5ka_: