Lineage for d4uu0a1 (4uu0 A:1-124,A:240-343,A:751-994)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028074Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 3028075Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family) (S)
  5. 3028076Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)
  6. 3028077Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 3028078Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (42 PDB entries)
    Uniprot P04191
  8. 3028117Domain d4uu0a1: 4uu0 A:1-124,A:240-343,A:751-994 [260091]
    Other proteins in same PDB: d4uu0a2, d4uu0a3, d4uu0a4
    automated match to d1wpga4
    complexed with gol, k, mg, so4, tbu, tg1

Details for d4uu0a1

PDB Entry: 4uu0 (more details), 2.5 Å

PDB Description: crystal structure of (sr) calcium-atpase e2(tg) in the presence of 14:1 pc
PDB Compounds: (A:) SERCA1a

SCOPe Domain Sequences for d4uu0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uu0a1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d4uu0a1:

Click to download the PDB-style file with coordinates for d4uu0a1.
(The format of our PDB-style files is described here.)

Timeline for d4uu0a1: