Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (14 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries) |
Domain d4urma_: 4urm A: [260090] automated match to d4k4oa_ complexed with xam |
PDB Entry: 4urm (more details), 2.94 Å
SCOPe Domain Sequences for d4urma_:
Sequence, based on SEQRES records: (download)
>d4urma_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr gipvdiqekmgrpaveviltvlhaggkfggggykvsgglhgvgssvvnalsqdlevyvhr netiyhqaykkgvpqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaf lnkgiqitlrderdeenvredsyhyeg
>d4urma_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} leaarkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwikvtdngr gipvdiqekmgrpaveviltvlhaggkgvgssvvnalsqdlevyvhrnetiyhqaykkgv pqfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrder deenvredsyhyeg
Timeline for d4urma_: