SCOPe 2.03: Domain d1bita_: 1bit A:

Lineage for d1bita_ (1bit A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Atlantic salmon (Salmo salar) [TaxId:8030] [50520] (11 PDB entries)

8. Domain d1bita_: 1bit A: [26008]
   complexed with ben, ca, so4

Details for d1bita_

PDB Entry: 1bit, 1.83 Å

PDB Description: the crystal structure of anionic salmon trypsin in a second crystal form

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1bita_:

Sequence; same for both SEQRES and ATOM records:

>d1bita_ b.47.1.2 (A:) Trypsin(ogen) {Atlantic salmon (Salmo salar) [TaxId: 8030]}
ivggyeckaysqahqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalptscapagtmctvsg
wgntmsstadsnklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstmasy

Timeline for d1bita_:

• d1bita_ first appeared (with stable ids) in SCOP 1.55, called d1bit__
  
• d1bita_ appears in SCOPe 2.02
  
• d1bita_ appears in SCOPe 2.04
  
• d1bita_ appears in the current release, SCOPe 2.08