Lineage for d4u7ja2 (4u7j A:173-398)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006436Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 3006437Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 3006484Family d.210.1.0: automated matches [227194] (1 protein)
    not a true family
  6. 3006485Protein automated matches [226921] (4 species)
    not a true protein
  7. 3006499Species Mycobacterium thermoresistibile [TaxId:1078020] [260071] (2 PDB entries)
  8. 3006502Domain d4u7ja2: 4u7j A:173-398 [260073]
    Other proteins in same PDB: d4u7ja1, d4u7jb1
    automated match to d1j20a2
    complexed with cl, edo

Details for d4u7ja2

PDB Entry: 4u7j (more details), 1.75 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d4u7ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u7ja2 d.210.1.0 (A:173-398) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
pfsidqnvwgravetgflehlwnaptkdvysytedptvnwstpdevivgfeqgvpvsidg
rsvtplqaieelnrrggeqgvgrldvvedrlvgiksreiyeapgamvlitahtelehvtl
erelgrfkritdqkwgelvydglwfsplktalesfvaktqehvtgeirmvlhgghiavng
rrspkslydfnlatydegdtfdqsaakgfvqihglsssisarrdlq

SCOPe Domain Coordinates for d4u7ja2:

Click to download the PDB-style file with coordinates for d4u7ja2.
(The format of our PDB-style files is described here.)

Timeline for d4u7ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u7ja1