SCOPe 2.04: Domain d4u1oa_: 4u1o A:

Lineage for d4u1oa_ (4u1o A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (124 PDB entries)

8. Domain d4u1oa_: 4u1o A: [260060]
   automated match to d4fata_
   complexed with fwf, kai

Details for d4u1oa_

PDB Entry: 4u1o, 1.85 Å

PDB Description: GluA2flip sLBD complexed with kainate and (R,R)-2b crystal form C

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d4u1oa_:

Sequence; same for both SEQRES and ATOM records:

>d4u1oa_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
anktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgky
gardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpi
esaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarv
rkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlkl
seqgvldklknkwwydkgecgs

Timeline for d4u1oa_:

• d4u1oa_ is new in SCOPe 2.04-stable
  
• d4u1oa_ appears in SCOPe 2.05
  
• d4u1oa_ appears in the current release, SCOPe 2.08, called d4u1oa1