Lineage for d4tqol_ (4tqo L:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. Superfamily a.137.2: Methanol dehydrogenase subunit [48666] (1 family) (S)
    consists of single alpha-helix and irregular N-terminal tail
    automatically mapped to Pfam PF02315
  5. Family a.137.2.1: Methanol dehydrogenase subunit [48667] (2 proteins)
  6. Protein automated matches [190583] (3 species)
    not a true protein
  7. Species Methylococcus capsulatus [TaxId:243233] [260039] (5 PDB entries)
  8. Domain d4tqol_: 4tqo L: [260041]
    Other proteins in same PDB: d4tqoa_, d4tqob_, d4tqoc_, d4tqod_, d4tqoe_, d4tqof_, d4tqog_, d4tqoh_
    automated match to d1w6sb_
    complexed with ca, pqq

Details for d4tqol_

PDB Entry: 4tqo (more details), 2.57 Å

PDB Description: the crystal structure of methanol dehydrogenase from methylococcus capsulatus (bath)
PDB Compounds: (L:) Methanol dehydrogenase, small subunit

SCOPe Domain Sequences for d4tqol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tqol_ a.137.2.1 (L:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
ydgthckapgncwepkpgypdkvagskydpkhdpnelnkqaesikamearnqkrvenyak
tgkfvykvedi

SCOPe Domain Coordinates for d4tqol_ are not available.

Timeline for d4tqol_:

Domains from other chains:
(mouse over for more information)
d4tqoa_, d4tqob_, d4tqoc_, d4tqod_, d4tqoe_, d4tqof_, d4tqog_, d4tqoh_, d4tqoi_, d4tqoj_, d4tqok_, d4tqom_, d4tqon_, d4tqoo_, d4tqop_