SCOPe 2.06: Domain d4tn1b1: 4tn1 B:517-744

Lineage for d4tn1b1 (4tn1 B:517-744)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [260027] (2 PDB entries)

8. Domain d4tn1b1: 4tn1 B:517-744 [260034]
   Other proteins in same PDB: d4tn1a2, d4tn1b2
   automated match to d1g7sa4
   complexed with gsp, mg; mutant

Details for d4tn1b1

PDB Entry: 4tn1, 2.75 Å

PDB Description: translation initiation factor eif5b (517-858) mutant d533r from c. thermophilum, bound to gtpgammas

PDB Compounds: (B:) eif5b

SCOPe Domain Sequences for d4tn1b1:

Sequence; same for both SEQRES and ATOM records:

>d4tn1b1 c.37.1.0 (B:517-744) automated matches {Chaetomium thermophilum [TaxId: 209285]}
nkdnlrspiccilghvrtgktklldkirqtnvqegeaggitqqigatyfpveaikqktav
vnkdgkfefkvpglliidtpghesfsnlrsrgsslcniailvvdimhglepqtieslrll
rerktpfvvalnkidrlygwkkienngfresfalqnkavqnefrnrldqvklqfaeqgfn
selfyenknfaryvslvptsahtgegipdmlklivqlcqermasslmy

Timeline for d4tn1b1:

• d4tn1b1 first appeared in SCOPe 2.04
  
• d4tn1b1 appears in SCOPe 2.05
  
• d4tn1b1 appears in SCOPe 2.07
  
• d4tn1b1 appears in the current release, SCOPe 2.08