SCOPe 2.05: Domain d4tmzb2: 4tmz B:745-846

Lineage for d4tmzb2 (4tmz B:745-846)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (19 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [260029] (2 PDB entries)

8. Domain d4tmzb2: 4tmz B:745-846 [260030]
   Other proteins in same PDB: d4tmza1, d4tmzb1
   automated match to d1g7sa1
   complexed with cl, gol, gsp, k, mg

Details for d4tmzb2

PDB Entry: 4tmz, 2.28 Å

PDB Description: translation initiation factor eif5b (517-858) from c. thermophilum, bound to gtpgammas and potassium

PDB Compounds: (B:) eif5b

SCOPe Domain Sequences for d4tmzb2:

Sequence; same for both SEQRES and ATOM records:

>d4tmzb2 b.43.3.0 (B:745-846) automated matches {Chaetomium thermophilum [TaxId: 209285]}
lselqatvlevkaiegfgvtidvilsngilregdrivlcglegpiktniralltpapmre
lrikgqyihhkevkaaqgvkisapglegaiagsrllvvgpdd

Timeline for d4tmzb2:

• d4tmzb2 first appeared in SCOPe 2.04
  
• d4tmzb2 appears in SCOPe 2.06
  
• d4tmzb2 appears in the current release, SCOPe 2.08