SCOPe 2.05: Domain d4tmzb1: 4tmz B:515-744

Lineage for d4tmzb1 (4tmz B:515-744)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [260027] (2 PDB entries)

8. Domain d4tmzb1: 4tmz B:515-744 [260028]
   Other proteins in same PDB: d4tmza2, d4tmzb2
   automated match to d1g7sa4
   complexed with cl, gol, gsp, k, mg

Details for d4tmzb1

PDB Entry: 4tmz, 2.28 Å

PDB Description: translation initiation factor eif5b (517-858) from c. thermophilum, bound to gtpgammas and potassium

PDB Compounds: (B:) eif5b

SCOPe Domain Sequences for d4tmzb1:

Sequence; same for both SEQRES and ATOM records:

>d4tmzb1 c.37.1.0 (B:515-744) automated matches {Chaetomium thermophilum [TaxId: 209285]}
hmnkdnlrspiccilghvdtgktklldkirqtnvqegeaggitqqigatyfpveaikqkt
avvnkdgkfefkvpglliidtpghesfsnlrsrgsslcniailvvdimhglepqtieslr
llrerktpfvvalnkidrlygwkkienngfresfalqnkavqnefrnrldqvklqfaeqg
fnselfyenknfaryvslvptsahtgegipdmlklivqlcqermasslmy

Timeline for d4tmzb1:

• d4tmzb1 first appeared in SCOPe 2.04
  
• d4tmzb1 appears in SCOPe 2.06
  
• d4tmzb1 appears in the current release, SCOPe 2.08