Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Anabaena variabilis [TaxId:240292] [256373] (9 PDB entries) |
Domain d4rdca_: 4rdc A: [260020] automated match to d4nqrb_ complexed with fmt, gol, mg, pro; mutant |
PDB Entry: 4rdc (more details), 1.2 Å
SCOPe Domain Sequences for d4rdca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rdca_ c.93.1.0 (A:) automated matches {Anabaena variabilis [TaxId: 240292]} ntipigialaqtsnvallgqeqvagakiaekyfndkggvngtpiklifqdtagdeagtin afqtlinkdkvvgivgptlsqqafsanpiaerakvpvvgpsntakgipeigdyvarvsap vsvvapnsvkaalkqnpnikkvavffaqndafskseteifqqtvkdqglelvtvqkfqtt dtdfqsqatnainlkpdlviisglaadggnlvrqlrelgyqgaiiggdglntsnvfavck alcdgvliaqayspeytgeinkafrqayvdqykkeppqfsaqafaavqvyveslkaldtk nkvskiqlpelrtelnkqlltgkyntplgeisftpigevvqkdfyvaqikmekdgsqgkf tflk
Timeline for d4rdca_: