![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (47 species) not a true protein |
![]() | Species Bacillus thuringiensis [TaxId:1444] [258998] (4 PDB entries) |
![]() | Domain d4qx0a3: 4qx0 A:500-644 [259998] Other proteins in same PDB: d4qx0a1, d4qx0a2 automated match to d1dlca1 |
PDB Entry: 4qx0 (more details), 2.8 Å
SCOPe Domain Sequences for d4qx0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qx0a3 b.18.1.0 (A:500-644) automated matches {Bacillus thuringiensis [TaxId: 1444]} ffnmidskkitqlplvkayklqsgasvvagprftggdiiqctengsaatiyvtpdvsysq kyrarihyastsqitftlsldgapfnqyyfdktinkgdtltynsfnlasfstpfelsgnn lqigvtglsagdkvyidkiefipvn
Timeline for d4qx0a3: