SCOPe 2.06: Domain d4qx0a2: 4qx0 A:290-499

Lineage for d4qx0a2 (4qx0 A:290-499)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families)

5. Family b.77.2.0: automated matches [254290] (1 protein)
   not a true family

6. Protein automated matches [254673] (3 species)
   not a true protein

7. Species Bacillus thuringiensis [TaxId:1444] [258996] (4 PDB entries)

8. Domain d4qx0a2: 4qx0 A:290-499 [259997]
   Other proteins in same PDB: d4qx0a1, d4qx0a3
   automated match to d1dlca2

Details for d4qx0a2

PDB Entry: 4qx0, 2.8 Å

PDB Description: cry3a toxin structure obtained by serial femtosecond crystallography from in vivo grown crystals isolated from bacillus thuringiensis and data processed with the cctbx.xfel software suite

PDB Compounds: (A:) Pesticidal crystal protein cry3Aa

SCOPe Domain Sequences for d4qx0a2:

Sequence; same for both SEQRES and ATOM records:

>d4qx0a2 b.77.2.0 (A:290-499) automated matches {Bacillus thuringiensis [TaxId: 1444]}
lypkevkteltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpg
yygndsfnywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnla
vwpsavysgvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgy
shqlnyvmcflmqgsrgtipvltwthksvd

Timeline for d4qx0a2:

• d4qx0a2 first appeared in SCOPe 2.04
  
• d4qx0a2 appears in SCOPe 2.05
  
• d4qx0a2 appears in SCOPe 2.07
  
• d4qx0a2 appears in the current release, SCOPe 2.08