Lineage for d4qmea1 (4qme A:2-188)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1562417Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 1562418Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 1562419Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 proteins)
  6. 1562420Protein Aminopeptidase N (APN) N-terminal domain [254399] (1 species)
  7. 1562421Species Neisseria meningitidis [TaxId:122586] [254835] (7 PDB entries)
  8. 1562422Domain d4qmea1: 4qme A:2-188 [259982]
    Other proteins in same PDB: d4qmea2, d4qmea3, d4qmea4
    automated match to d2gtqa1
    complexed with 37b, gol, imd, so4, zn

Details for d4qmea1

PDB Entry: 4qme (more details), 1.6 Å

PDB Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qmea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qmea1 b.98.1.1 (A:2-188) Aminopeptidase N (APN) N-terminal domain {Neisseria meningitidis [TaxId: 122586]}
sktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvk
ingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegf
rkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsy
lfalvag

SCOPe Domain Coordinates for d4qmea1:

Click to download the PDB-style file with coordinates for d4qmea1.
(The format of our PDB-style files is described here.)

Timeline for d4qmea1: