Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qltm_: 4qlt M: [259977] Other proteins in same PDB: d4qlta_, d4qltb_, d4qltc2, d4qlte_, d4qltg_, d4qlti_, d4qltj_, d4qltk_, d4qltl_, d4qltn_, d4qlto_, d4qltq2, d4qlts_, d4qltu_, d4qltw_, d4qltx_, d4qlty_, d4qltz_ automated match to d4j70m_ complexed with 39v, mes, mg |
PDB Entry: 4qlt (more details), 2.8 Å
SCOPe Domain Sequences for d4qltm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qltm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d4qltm_:
View in 3D Domains from other chains: (mouse over for more information) d4qlta_, d4qltb_, d4qltc1, d4qltc2, d4qltd_, d4qlte_, d4qltf_, d4qltg_, d4qlth_, d4qlti_, d4qltj_, d4qltk_, d4qltl_, d4qltn_, d4qlto_, d4qltp_, d4qltq1, d4qltq2, d4qltr_, d4qlts_, d4qltt_, d4qltu_, d4qltv_, d4qltw_, d4qltx_, d4qlty_, d4qltz_ |