Lineage for d4qira2 (4qir A:189-438)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661524Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (4 proteins)
    adopts thermolysin-like fold
  6. 1661525Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)
  7. 1661526Species Neisseria meningitidis [TaxId:122586] [254836] (7 PDB entries)
  8. 1661529Domain d4qira2: 4qir A:189-438 [259973]
    Other proteins in same PDB: d4qira1, d4qira3, d4qira4
    automated match to d2gtqa2
    complexed with 379, gol, imd, so4, zn

Details for d4qira2

PDB Entry: 4qir (more details), 1.7 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-2-(pyridin-3-yl)ethylglyp[ch2]phe
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4qira2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qira2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4qira2:

Click to download the PDB-style file with coordinates for d4qira2.
(The format of our PDB-style files is described here.)

Timeline for d4qira2: