SCOPe 2.04: Domain d4q5sf3: 4q5s F:319-422

Lineage for d4q5sf3 (4q5s F:319-422)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.0: automated matches [254211] (1 protein)
   not a true family

6. Protein automated matches [254475] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [257268] (3 PDB entries)

8. Domain d4q5sf3: 4q5s F:319-422 [259969]
   Other proteins in same PDB: d4q5sd_, d4q5se_, d4q5sf1
   automated match to d1smyf2
   protein/DNA complex; protein/RNA complex; complexed with atp, mg, zn

Details for d4q5sf3

PDB Entry: 4q5s, 3 Å

PDB Description: Thermus thermophilus RNA polymerase initially transcribing complex containing 6-mer RNA

PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d4q5sf3:

Sequence, based on SEQRES records:

>d4q5sf3 a.4.13.0 (F:319-422) automated matches {Thermus thermophilus [TaxId: 300852]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfl

Sequence, based on observed residues (ATOM records):

>d4q5sf3 a.4.13.0 (F:319-422) automated matches {Thermus thermophilus [TaxId: 300852]}
tpfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidgrehtlee
vgaffgvtrerirqienkalrklkyhesrtrklrdfl

Timeline for d4q5sf3:

• d4q5sf3 is new in SCOPe 2.04-stable
  
• d4q5sf3 appears in SCOPe 2.05
  
• d4q5sf3 appears in the current release, SCOPe 2.08