Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries) |
Domain d4poub_: 4pou B: [259962] Other proteins in same PDB: d4poua_ automated match to d2p49b_ |
PDB Entry: 4pou (more details), 1.75 Å
SCOPe Domain Sequences for d4poub_:
Sequence, based on SEQRES records: (download)
>d4poub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesggglvqagggslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtl yadsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyqlrdrtyghwgqgtqvtv ss
>d4poub_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesggglvqagslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtlya dsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyqlrdrtyghwgqgtqvtvss
Timeline for d4poub_: