Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4pjdh2: 4pjd H:116-241 [259951] Other proteins in same PDB: d4pjda1, d4pjda2, d4pjdb_, d4pjdc1, d4pjdc2, d4pjdd_, d4pjde1, d4pjdf1, d4pjdg1, d4pjdh1 automated match to d3of6b2 complexed with 2lj, gol |
PDB Entry: 4pjd (more details), 2.78 Å
SCOPe Domain Sequences for d4pjdh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjdh2 b.1.1.2 (H:116-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs aeawgr
Timeline for d4pjdh2: