SCOPe 2.05: Domain d4pjxh1: 4pjx H:3-116

Lineage for d4pjxh1 (4pjx H:3-116)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4pjxh1: 4pjx H:3-116 [259946]
   Other proteins in same PDB: d4pjxa1, d4pjxb_, d4pjxc1, d4pjxd_, d4pjxe2, d4pjxf2, d4pjxg2, d4pjxh2
   automated match to d3of6c1
   complexed with 30w, b3p, cl, gol

Details for d4pjxh1

PDB Entry: 4pjx, 2.25 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-a11 tcr

PDB Compounds: (H:) TCR-beta

SCOPe Domain Sequences for d4pjxh1:

Sequence; same for both SEQRES and ATOM records:

>d4pjxh1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassaaveggntiyfgegsrltvled

Timeline for d4pjxh1:

• d4pjxh1 first appeared in SCOPe 2.04
  
• d4pjxh1 appears in SCOPe 2.06
  
• d4pjxh1 appears in the current release, SCOPe 2.08