SCOPe 2.04: Domain d4pjge2: 4pjg E:111-199

Lineage for d4pjge2 (4pjg E:111-199)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4pjge2: 4pjg E:111-199 [259937]
   Other proteins in same PDB: d4pjge1
   automated match to d2f54d2
   complexed with 30w

Details for d4pjge2

PDB Entry: 4pjg, 2.4 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-f3-c1 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjge2:

Sequence; same for both SEQRES and ATOM records:

>d4pjge2 b.1.1.2 (E:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4pjge2:

• d4pjge2 is new in SCOPe 2.04-stable
  
• d4pjge2 appears in SCOPe 2.05
  
• d4pjge2 appears in the current release, SCOPe 2.08