SCOPe 2.04: Domain d4pjvb2: 4pjv B:365-579

Lineage for d4pjvb2 (4pjv B:365-579)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
   automatically mapped to Pfam PF00644

6. Protein automated matches [227023] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225783] (3 PDB entries)

8. Domain d4pjvb2: 4pjv B:365-579 [259933]
   Other proteins in same PDB: d4pjva1, d4pjvb1
   automated match to d3kjda2
   complexed with 2yq, gol

Details for d4pjvb2

PDB Entry: 4pjv, 2.5 Å

PDB Description: Structure of PARP2 catalytic domain bound to inhibitor BMN 673

PDB Compounds: (B:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4pjvb2:

Sequence, based on SEQRES records:

>d4pjvb2 d.166.1.2 (B:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilnpdgytlnyneyivynpnqvrmryllkvqfnf

Sequence, based on observed residues (ATOM records):

>d4pjvb2 d.166.1.2 (B:365-579) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhcalrpldhesyefkvisqylqsthapthsdytmtlldlfevekdgekeafredlhnrm
llwhgsrmsnwvgilshglriahpeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaegllqgkhstkglgkmapssahfvtlngstvplgpasdt
gilgytlnyneyivynpnqvrmryllkvqfnf

Timeline for d4pjvb2:

• d4pjvb2 is new in SCOPe 2.04-stable
  
• d4pjvb2 appears in SCOPe 2.05
  
• d4pjvb2 appears in the current release, SCOPe 2.08