Class a: All alpha proteins [46456] (289 folds) |
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
Protein automated matches [226964] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries) |
Domain d4pjva1: 4pjv A:235-364 [259930] Other proteins in same PDB: d4pjva2, d4pjva3, d4pjvb2, d4pjvb3 automated match to d3kcza1 complexed with 2yq, gol |
PDB Entry: 4pjv (more details), 2.5 Å
SCOPe Domain Sequences for d4pjva1:
Sequence, based on SEQRES records: (download)
>d4pjva1 a.41.1.0 (A:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragqh gralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqsp ehpldqhyrn
>d4pjva1 a.41.1.0 (A:235-364) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragra lmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkteehpldqh yrn
Timeline for d4pjva1: