SCOPe 2.04: Domain d4pjva1: 4pjv A:234-364

Lineage for d4pjva1 (4pjv A:234-364)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (24 PDB entries)

8. Domain d4pjva1: 4pjv A:234-364 [259930]
   Other proteins in same PDB: d4pjva2, d4pjvb2
   automated match to d3kcza1
   complexed with 2yq, gol

Details for d4pjva1

PDB Entry: 4pjv, 2.5 Å

PDB Description: Structure of PARP2 catalytic domain bound to inhibitor BMN 673

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 2

SCOPe Domain Sequences for d4pjva1:

Sequence, based on SEQRES records:

>d4pjva1 a.41.1.0 (A:234-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragq
hgralmeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvktelqs
pehpldqhyrn

Sequence, based on observed residues (ATOM records):

>d4pjva1 a.41.1.0 (A:234-364) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdlrvqeliklicnvqameemmmemkyntkkaplgkltvaqikagyqslkkiedciragr
almeacnefytriphdfglrtpplirtqkelsekiqllealgdieiaiklvkteehpldq
hyrn

Timeline for d4pjva1:

• d4pjva1 is new in SCOPe 2.04-stable
  
• d4pjva1 appears in SCOPe 2.05
  
• d4pjva1 appears in the current release, SCOPe 2.08