SCOPe 2.03: Domain d1brce_: 1brc E:

Lineage for d1brce_ (1brc E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (36 PDB entries)

8. Domain d1brce_: 1brc E: [25993]
   Other proteins in same PDB: d1brci_

Details for d1brce_

PDB Entry: 1brc, 2.5 Å

PDB Description: relocating a negative charge in the binding pocket of trypsin

PDB Compounds: (E:) Trypsin

SCOPe Domain Sequences for d1brce_:

Sequence; same for both SEQRES and ATOM records:

>d1brce_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

Timeline for d1brce_:

• d1brce_ first appeared (with stable ids) in SCOP 1.55
  
• d1brce_ appears in SCOPe 2.02
  
• d1brce_ appears in SCOPe 2.04
  
• d1brce_ appears in the current release, SCOPe 2.08