Lineage for d4pjba2 (4pjb A:179-269)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033546Domain d4pjba2: 4pjb A:179-269 [259929]
    Other proteins in same PDB: d4pjba1, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc3, d4pjbd_, d4pjbe2, d4pjbf2, d4pjbg2, d4pjbh2
    automated match to d4l4ta2
    complexed with 2lj, gol

Details for d4pjba2

PDB Entry: 4pjb (more details), 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjba2:

Sequence, based on SEQRES records: (download)

>d4pjba2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pjba2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

SCOPe Domain Coordinates for d4pjba2:

Click to download the PDB-style file with coordinates for d4pjba2.
(The format of our PDB-style files is described here.)

Timeline for d4pjba2: