Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Sorghum (Sorghum bicolor) [TaxId:4558] [258128] (2 PDB entries) |
Domain d4pghc1: 4pgh C:10-116 [259921] Other proteins in same PDB: d4pgha2, d4pghb2, d4pghc2, d4pghd2 automated match to d3p9id1 complexed with sam |
PDB Entry: 4pgh (more details), 2.8 Å
SCOPe Domain Sequences for d4pghc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pghc1 a.4.5.0 (C:10-116) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]} avadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpvaptnp aaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpne
Timeline for d4pghc1: