Lineage for d4pghc1 (4pgh C:10-116)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984559Species Sorghum (Sorghum bicolor) [TaxId:4558] [258128] (2 PDB entries)
  8. 1984564Domain d4pghc1: 4pgh C:10-116 [259921]
    Other proteins in same PDB: d4pgha2, d4pghb2, d4pghc2, d4pghd2
    automated match to d3p9id1
    complexed with sam

Details for d4pghc1

PDB Entry: 4pgh (more details), 2.8 Å

PDB Description: caffeic acid o-methyltransferase from sorghum bicolor
PDB Compounds: (C:) Caffeic acid O-methyltransferase

SCOPe Domain Sequences for d4pghc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pghc1 a.4.5.0 (C:10-116) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]}
avadeeacmyamqlasssilpmtlknalelgllevlqkdagkalaaeevvarlpvaptnp
aaadmvdrmlrllasydvvkcqmedkdgkyerrysaapvgkwltpne

SCOPe Domain Coordinates for d4pghc1:

Click to download the PDB-style file with coordinates for d4pghc1.
(The format of our PDB-style files is described here.)

Timeline for d4pghc1: