Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (11 species) not a true protein |
Species Pseudomonas mendocina [TaxId:300] [188695] (20 PDB entries) |
Domain d4p1cd_: 4p1c D: [259897] Other proteins in same PDB: d4p1cc_, d4p1cf_, d4p1ch_, d4p1ci_ automated match to d3ge8d_ complexed with fe, fes, peg |
PDB Entry: 4p1c (more details), 2.4 Å
SCOPe Domain Sequences for d4p1cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p1cd_ a.25.1.2 (D:) automated matches {Pseudomonas mendocina [TaxId: 300]} amhprkdwyeltratnwtpsyvteeqlfpermsghmgiplekwesydepyktsypeyvsi qrekdagaysvkaalerakiyensdpgwistlkshygaiavgeyaavtgegrmarfskap gnrnmatfgmmdelrhgqlqlffpheyckkdrqfdwawrayhsnewaaiaakhffddiit grdaisvaimltfsfetgftnmqflglaadaaeagdytfanlissiqtdesrhaqqggpa lqlliengkreeaqkkvdmaiwrawrlfavltgpvmdyytpledrsqsfkefmyewiigq ferslidlgldkpwywdlflkdidelhhsyhmgvwywrttawwnpaagvtpeerdwleek ypgwnkrwgrcwdvitenvlndrmdlvspetlpsvcnmsqiplvgvpgddwnievfsleh ngrlyhfgsevdrwvfqqdpvqyqnhmnivdrflagqiqpmtlegalkymgfqsieemgk dahdfawadk
Timeline for d4p1cd_: