SCOPe 2.04: Domain d4oeva_: 4oev A:

Lineage for d4oeva_ (4oev A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (87 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [259851] (2 PDB entries)

8. Domain d4oeva_: 4oev A: [259855]
   automated match to d1xoca1
   complexed with gol, ni, oxl

Details for d4oeva_

PDB Entry: 4oev, 1.9 Å

PDB Description: Crystal structure of NikZ from Campylobacter jejuni in complex with Ni(II) ion

PDB Compounds: (A:) Putative peptide ABC-transport system periplasmic peptide-binding protein

SCOPe Domain Sequences for d4oeva_:

Sequence; same for both SEQRES and ATOM records:

>d4oeva_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
kipkdtliiaveneiarinpaysedhdavinlvfsgltrfdenmslkpdlakswdiskdg
lvydiflrddvlwhdgvkfsaddvkfsieafknpknnssiyvnfediksveilnpshvki
tlfkpypafldalsigmlpkhllenenlntssfnqnpigtgpykfvkwkkgeyvefkane
hfyldkvktprliikhifdpsiasaelkngkidaalidvsllnifkndenfgilreksad
yralmfnldneflkdlkvrqalnyavdkesivknllhdyafvanhplerswansknfkiy
kydpkkaedllvsagfkknkdgnfekdgkilefeiwamsndplrvslagilqsefrkigv
vskvvakpagsfdyskvdsfligwgspldpdfhtfrvfessqdsalndegwnfghyhdkk
vdialqkarntsnleerkkyykdfidalyenppfiflayldfalvynkdlkgiktrtlgh
hgvgftwnvyewsk

Timeline for d4oeva_:

• d4oeva_ is new in SCOPe 2.04-stable
  
• d4oeva_ appears in SCOPe 2.05
  
• d4oeva_ appears in the current release, SCOPe 2.08