Lineage for d4o4za_ (4o4z A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475036Protein Neuroglobin [100978] (2 species)
  7. 1475043Species Mouse (Mus musculus) [TaxId:10090] [109625] (12 PDB entries)
    Uniprot Q9ER97
  8. 1475048Domain d4o4za_: 4o4z A: [259849]
    automated match to d1oj6b_
    complexed with hem, n2o, so4

Details for d4o4za_

PDB Entry: 4o4z (more details), 1.7 Å

PDB Description: murine neuroglobin under 30 bar pressure nitrous oxide
PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d4o4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4za_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

SCOPe Domain Coordinates for d4o4za_:

Click to download the PDB-style file with coordinates for d4o4za_.
(The format of our PDB-style files is described here.)

Timeline for d4o4za_: