SCOPe 2.04: Domain d4nfgb_: 4nfg B:

Lineage for d4nfgb_ (4nfg B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (15 species)
   not a true protein

7. Species Equus caballus [TaxId:9796] [259832] (1 PDB entry)

8. Domain d4nfgb_: 4nfg B: [259833]
   Other proteins in same PDB: d4nfga_
   automated match to d3o1ya_
   complexed with hec, hem, unx; mutant

Details for d4nfgb_

PDB Entry: 4nfg, 2.11 Å

PDB Description: K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex

PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d4nfgb_:

Sequence; same for both SEQRES and ATOM records:

>d4nfgb_ a.3.1.1 (B:) automated matches {Equus caballus [TaxId: 9796]}
gdvekgkkifvqrcaqchtvekggknktgpnlnglfgrktgqapgftytdanknkgitwk
eetlmeylenpkkyipgtkmifagikkkteredliaylkkatne

Timeline for d4nfgb_:

• d4nfgb_ is new in SCOPe 2.04-stable
  
• d4nfgb_ appears in SCOPe 2.05
  
• d4nfgb_ appears in the current release, SCOPe 2.08