Lineage for d1brbe_ (1brb E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 671094Protein Trypsin(ogen) [50515] (9 species)
  7. 671445Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (33 PDB entries)
  8. 671466Domain d1brbe_: 1brb E: [25983]
    Other proteins in same PDB: d1brbi_

Details for d1brbe_

PDB Entry: 1brb (more details), 2.1 Å

PDB Description: crystal structures of rat anionic trypsin complexed with the protein inhibitors appi and bpti
PDB Compounds: (E:) Trypsin

SCOP Domain Sequences for d1brbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brbe_ b.47.1.2 (E:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}
ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan

SCOP Domain Coordinates for d1brbe_:

Click to download the PDB-style file with coordinates for d1brbe_.
(The format of our PDB-style files is described here.)

Timeline for d1brbe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1brbi_