SCOPe 2.05: Domain d4mxga_: 4mxg A:

Lineage for d4mxga_ (4mxg A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (31 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189201] (22 PDB entries)

8. Domain d4mxga_: 4mxg A: [259818]
   automated match to d3niaa_
   complexed with cl, flc, mpd

Details for d4mxga_

PDB Entry: 4mxg, 1.48 Å

PDB Description: crystal structure of extended-spectrum beta-lactamase bel-1 (monoclinic form)

PDB Compounds: (A:) bel-1

SCOPe Domain Sequences for d4mxga_:

Sequence; same for both SEQRES and ATOM records:

>d4mxga_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage
enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl
ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql
rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape
lqgeeralliasvaklarqyvvh

Timeline for d4mxga_:

• d4mxga_ first appeared in SCOPe 2.04
  
• d4mxga_ last appears in SCOPe 2.06