Lineage for d4mu0a1 (4mu0 A:9-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931148Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259809] (11 PDB entries)
  8. 2931152Domain d4mu0a1: 4mu0 A:9-95 [259814]
    Other proteins in same PDB: d4mu0a2
    automated match to d2f1da1
    complexed with cl, edo, mn, tri, trs

Details for d4mu0a1

PDB Entry: 4mu0 (more details), 1.3 Å

PDB Description: the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4- triazole at 1.3 a resolution
PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4mu0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mu0a1 d.14.1.0 (A:9-95) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
hiddhhtnedvalaigtallkalgerk

SCOPe Domain Coordinates for d4mu0a1:

Click to download the PDB-style file with coordinates for d4mu0a1.
(The format of our PDB-style files is described here.)

Timeline for d4mu0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mu0a2