SCOPe 2.05: Domain d4mu3a2: 4mu3 A:96-194

Lineage for d4mu3a2 (4mu3 A:96-194)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein automated matches [254526] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (7 PDB entries)

8. Domain d4mu3a2: 4mu3 A:96-194 [259811]
   Other proteins in same PDB: d4mu3a1
   automated match to d2f1da2
   complexed with edo, ig2, iyp, mn; mutant

Details for d4mu3a2

PDB Entry: 4mu3, 1.12 Å

PDB Description: the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution

PDB Compounds: (A:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4mu3a2:

Sequence; same for both SEQRES and ATOM records:

>d4mu3a2 d.14.1.9 (A:96-194) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprrg

Timeline for d4mu3a2:

• d4mu3a2 first appeared in SCOPe 2.04
  
• d4mu3a2 appears in SCOPe 2.06
  
• d4mu3a2 appears in the current release, SCOPe 2.08