Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
Protein automated matches [254526] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (7 PDB entries) |
Domain d4mu3a2: 4mu3 A:96-194 [259811] Other proteins in same PDB: d4mu3a1 automated match to d2f1da2 complexed with edo, ig2, iyp, mn; mutant |
PDB Entry: 4mu3 (more details), 1.12 Å
SCOPe Domain Sequences for d4mu3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mu3a2 d.14.1.9 (A:96-194) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg mtlhirqlagknshhiieatfkafaralrqatesdprrg
Timeline for d4mu3a2: