Lineage for d4ms8a1 (4ms8 A:1-175)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183780Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries)
  8. 2183785Domain d4ms8a1: 4ms8 A:1-175 [259802]
    Other proteins in same PDB: d4ms8a2, d4ms8c1, d4ms8c2, d4ms8d1, d4ms8d2
    automated match to d2wy3a_

Details for d4ms8a1

PDB Entry: 4ms8 (more details), 1.92 Å

PDB Description: 42f3 tcr pcpb9/h-2ld complex
PDB Compounds: (A:) H-2 class I histocompatibility antigen, L-D alpha chain

SCOPe Domain Sequences for d4ms8a1:

Sequence, based on SEQRES records: (download)

>d4ms8a1 d.19.1.0 (A:1-175) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gphsmryyetatsrrglgeprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpeyw
eritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfaydg
cdyialnedlrtwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkng

Sequence, based on observed residues (ATOM records): (download)

>d4ms8a1 d.19.1.0 (A:1-175) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gphsmryyetatsprytsvgyvddkefvrfdsdaenpryepqvpwmeqegpeyweritqi
akgqeqwfrvnlrtllgyhtlqwmygcdvgsdgrllrgyeqfaydgcdyialnedlrtwt
aadmaaqitrrkweqagaaeyyraylegecvewlhrylkng

SCOPe Domain Coordinates for d4ms8a1:

Click to download the PDB-style file with coordinates for d4ms8a1.
(The format of our PDB-style files is described here.)

Timeline for d4ms8a1: