SCOPe 2.04: Domain d4l6pa1: 4l6p A:0-126

Lineage for d4l6pa1 (4l6p A:0-126)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein automated matches [227006] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries)

8. Domain d4l6pa1: 4l6p A:0-126 [259790]
   automated match to d1plqa1
   complexed with gol; mutant

Details for d4l6pa1

PDB Entry: 4l6p, 2.68 Å

PDB Description: structure of c22y mutant pcna protein defective in dna mismatch repair

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d4l6pa1:

Sequence; same for both SEQRES and ATOM records:

>d4l6pa1 d.131.1.2 (A:0-126) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
hmleakfeeaslfkriidgfkdyvqlvnfqckedgiiaqavddsrvllvsleigveafqe
yrcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklm
didadfl

Timeline for d4l6pa1:

• d4l6pa1 is new in SCOPe 2.04-stable
  
• d4l6pa1 appears in SCOPe 2.05
  
• d4l6pa1 appears in the current release, SCOPe 2.08