Lineage for d1fy8e_ (1fy8 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2406157Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)
  8. 2406179Domain d1fy8e_: 1fy8 E: [25978]
    Other proteins in same PDB: d1fy8i_
    complexed with ca, so4

Details for d1fy8e_

PDB Entry: 1fy8 (more details), 1.7 Å

PDB Description: crystal structure of the deltaile16val17 rat anionic trypsinogen-bpti complex
PDB Compounds: (E:) trypsin II, anionic

SCOPe Domain Sequences for d1fy8e_:

Sequence, based on SEQRES records: (download)

>d1fy8e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records): (download)

>d1fy8e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgnpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelq
givswgygcalpdnpgvytkvcnyvdwiqdtiaan

SCOPe Domain Coordinates for d1fy8e_:

Click to download the PDB-style file with coordinates for d1fy8e_.
(The format of our PDB-style files is described here.)

Timeline for d1fy8e_: