SCOPe 2.07: Domain d1fy8e_: 1fy8 E:

Lineage for d1fy8e_ (1fy8 E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [50518] (37 PDB entries)

8. Domain d1fy8e_: 1fy8 E: [25978]
   Other proteins in same PDB: d1fy8i_
   complexed with ca, so4

Details for d1fy8e_

PDB Entry: 1fy8, 1.7 Å

PDB Description: crystal structure of the deltaile16val17 rat anionic trypsinogen-bpti complex

PDB Compounds: (E:) trypsin II, anionic

SCOPe Domain Sequences for d1fy8e_:

Sequence, based on SEQRES records:

>d1fy8e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggp
vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan

Sequence, based on observed residues (ATOM records):

>d1fy8e_ b.47.1.2 (E:) Trypsin(ogen) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dkggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
wgnpdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdsggpvvcngelq
givswgygcalpdnpgvytkvcnyvdwiqdtiaan

Timeline for d1fy8e_:

• d1fy8e_ first appeared (with stable ids) in SCOP 1.55
  
• d1fy8e_ appears in SCOPe 2.06
  
• d1fy8e_ appears in the current release, SCOPe 2.08