Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (28 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225745] (14 PDB entries) |
Domain d4c2zb2: 4c2z B:296-496 [259747] automated match to d3iu1a2 complexed with 646, cit, cl, gol, mg, mya |
PDB Entry: 4c2z (more details), 2.08 Å
SCOPe Domain Sequences for d4c2zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2zb2 d.108.1.0 (B:296-496) automated matches {Human (Homo sapiens) [TaxId: 9606]} ywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltr ylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthks lkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlq yylynwkcpsmgaekvglvlq
Timeline for d4c2zb2: