Lineage for d3wifb2 (3wif B:113-216)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030645Domain d3wifb2: 3wif B:113-216 [259740]
    Other proteins in same PDB: d3wifb1
    automated match to d2ojzl2
    complexed with on5

Details for d3wifb2

PDB Entry: 3wif (more details), 1.7 Å

PDB Description: Crystal structure of anti-prostaglandin E2 Fab fragment 9Cl-PGF2beta complex
PDB Compounds: (B:) mAb Fab L fragment

SCOPe Domain Sequences for d3wifb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wifb2 b.1.1.2 (B:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3wifb2:

Click to download the PDB-style file with coordinates for d3wifb2.
(The format of our PDB-style files is described here.)

Timeline for d3wifb2: