Lineage for d4uohc_ (4uoh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951824Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries)
  8. 2951827Domain d4uohc_: 4uoh C: [259728]
    automated match to d4f36e_
    complexed with adp, mg

Details for d4uohc_

PDB Entry: 4uoh (more details), 2.01 Å

PDB Description: Crystallographic structure of nucleoside diphosphate kinase from Litopenaeus vannamei complexed with ADP
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4uohc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uohc_ d.58.6.0 (C:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy
pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd
svesankeialwfkpeelvswtqtneswiye

SCOPe Domain Coordinates for d4uohc_:

Click to download the PDB-style file with coordinates for d4uohc_.
(The format of our PDB-style files is described here.)

Timeline for d4uohc_: