Lineage for d4r9oa_ (4r9o A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829537Protein automated matches [190169] (7 species)
    not a true protein
  7. 2829657Species Salmonella enterica [TaxId:99287] [259716] (1 PDB entry)
  8. 2829658Domain d4r9oa_: 4r9o A: [259717]
    automated match to d1ur3m_

Details for d4r9oa_

PDB Entry: 4r9o (more details), 1.95 Å

PDB Description: Crystal Structure of Putative Aldo/Keto Reductase from Salmonella enterica
PDB Compounds: (A:) Putative aldo/keto reductase

SCOPe Domain Sequences for d4r9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9oa_ c.1.7.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mvqrvtiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqc
eaafgealtlaphlreklqivtkcgiattaraenklghyitdrrhiilsaeqslknlatd
yldmllihrpdplmdaddvaeafqhlhqsgkvrhfgvsnftpaqftllqsrlpftlatnq
veispvhqpllldgtldqlqqlrirpmawsclgggrlfndeayqplrqelsviaqelnas
sieqvvyawilrlpsqplpiigsgkiervraaleaetlsltrqqwfrirkaal

SCOPe Domain Coordinates for d4r9oa_:

Click to download the PDB-style file with coordinates for d4r9oa_.
(The format of our PDB-style files is described here.)

Timeline for d4r9oa_: