Lineage for d4pz4a_ (4pz4 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682595Family d.169.1.4: Link domain [56477] (3 proteins)
  6. 1682611Protein automated matches [190733] (2 species)
    not a true protein
  7. 1682612Species Homo sapiens [TaxId:9606] [259697] (2 PDB entries)
  8. 1682615Domain d4pz4a_: 4pz4 A: [259698]
    automated match to d1poza_
    complexed with dms, edo, gol, peg, so4

Details for d4pz4a_

PDB Entry: 4pz4 (more details), 1.6 Å

PDB Description: High-resolution crystal structure of the human CD44 hyaluronan binding domain in new space group
PDB Compounds: (A:) CD44 antigen

SCOPe Domain Sequences for d4pz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pz4a_ d.169.1.4 (A:) automated matches {Homo sapiens [TaxId: 9606]}
amaqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetc
rygfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpn
afdgpititivnrdgtryvqkgeyrtnpediyps

SCOPe Domain Coordinates for d4pz4a_:

Click to download the PDB-style file with coordinates for d4pz4a_.
(The format of our PDB-style files is described here.)

Timeline for d4pz4a_: