Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.4: Link domain [56477] (3 proteins) |
Protein automated matches [190733] (2 species) not a true protein |
Species Homo sapiens [TaxId:9606] [259697] (2 PDB entries) |
Domain d4pz4a_: 4pz4 A: [259698] automated match to d1poza_ complexed with dms, edo, gol, peg, so4 |
PDB Entry: 4pz4 (more details), 1.6 Å
SCOPe Domain Sequences for d4pz4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pz4a_ d.169.1.4 (A:) automated matches {Homo sapiens [TaxId: 9606]} amaqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetc rygfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpn afdgpititivnrdgtryvqkgeyrtnpediyps
Timeline for d4pz4a_: