SCOPe 2.05: Domain d4pa1a_: 4pa1 A:

Lineage for d4pa1a_ (4pa1 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Feline immunodeficiency virus [TaxId:11674] [259692] (1 PDB entry)

8. Domain d4pa1a_: 4pa1 A: [259693]
   automated match to d3kksb_

Details for d4pa1a_

PDB Entry: 4pa1, 1.84 Å

PDB Description: Crystal Structure of Catalytic Core domain of FIV Integrase

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d4pa1a_:

Sequence; same for both SEQRES and ATOM records:

>d4pa1a_ c.55.3.0 (A:) automated matches {Feline immunodeficiency virus [TaxId: 11674]}
hmgiwqmdcthfdgkiilvgihvesgyiwaqiisqetadctvkavlqllsahnvtelqtd
ngpnfknqkmegvlnymgvkhkfgipgnpqsqalvenvnhtlkvwiqkflpettsldnal
slavhslnfkrrgriggmapyellaqqeslr

Timeline for d4pa1a_:

• d4pa1a_ first appeared in SCOPe 2.04
  
• d4pa1a_ is called d4pa1a1 in SCOPe 2.06
  
• d4pa1a_ appears in the current release, SCOPe 2.08, called d4pa1a1