SCOPe 2.06: Domain d4p7wa1: 4p7w A:2-280

Lineage for d4p7wa1 (4p7w A:2-280)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.0: automated matches [191672] (1 protein)
   not a true family

6. Protein automated matches [191281] (13 species)
   not a true protein

7. Species Rhizobium loti [TaxId:266835] [259686] (2 PDB entries)

8. Domain d4p7wa1: 4p7w A:2-280 [259687]
   Other proteins in same PDB: d4p7wa2
   automated match to d1e5sa_
   complexed with akg, co, pro

Details for d4p7wa1

PDB Entry: 4p7w, 1.8 Å

PDB Description: l-proline-bound l-proline cis-4-hydroxylase

PDB Compounds: (A:) L-proline cis-4-hydroxylase

SCOPe Domain Sequences for d4p7wa1:

Sequence; same for both SEQRES and ATOM records:

>d4p7wa1 b.82.2.0 (A:2-280) automated matches {Rhizobium loti [TaxId: 266835]}
ttrilgvvqldqrrltddlavlaksnfsseysdfacgrwefcmlrnqsgkqeeqrvvvhe
tpalatplgqslpylnelldnhfdrdsiryariirisenaciiphrdylelegkfirvhl
vldtnekcsnteennifhmgrgeiwfldaslphsagcfsptprlhlvvdiegtrsleeva
inveqpsarnatvdtrkewtdetlesvlgfseiiseanyreivailaklhffhkvhcvdm
ygwlkeicrrrgepaliekanslerfylidraagevmty

Timeline for d4p7wa1:

• d4p7wa1 first appeared in SCOPe 2.04, called d4p7wa_
  
• d4p7wa1 was called d4p7wa_ in SCOPe 2.05
  
• d4p7wa1 appears in SCOPe 2.07
  
• d4p7wa1 appears in the current release, SCOPe 2.08