SCOPe 2.08: Domain d2m5ra1: 2m5r A:3-80

Lineage for d2m5ra1 (2m5r A:3-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [259666] (3 PDB entries)

8. Domain d2m5ra1: 2m5r A:3-80 [259667]
   Other proteins in same PDB: d2m5ra2
   automated match to d2x2ba_
   complexed with pns

Details for d2m5ra1

PDB Entry: 2m5r

PDB Description: Solution structure of holo-acyl carrier protein of Leishmania major

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2m5ra1:

Sequence; same for both SEQRES and ATOM records:

>d2m5ra1 a.28.1.0 (A:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak

Timeline for d2m5ra1:

• d2m5ra1 first appeared in SCOPe 2.04, called d2m5ra_
  
• d2m5ra1 appears in SCOPe 2.07