Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein (Apo)ferritin [47246] (8 species) |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries) |
Domain d4lqja_: 4lqj A: [259658] automated match to d1mfra_ complexed with cl, fe2, mg |
PDB Entry: 4lqj (more details), 1.2 Å
SCOPe Domain Sequences for d4lqja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lqja_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes
Timeline for d4lqja_: