Lineage for d4iw3a_ (4iw3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1808208Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 1808209Protein automated matches [191281] (9 species)
    not a true protein
  7. 1808254Species Pseudomonas putida [TaxId:160488] [259652] (2 PDB entries)
  8. 1808263Domain d4iw3a_: 4iw3 A: [259653]
    Other proteins in same PDB: d4iw3b1, d4iw3b2, d4iw3b3, d4iw3k1, d4iw3k2, d4iw3k3
    automated match to d4jzra_
    complexed with gdp, mg, mn, oga

Details for d4iw3a_

PDB Entry: 4iw3 (more details), 2.7 Å

PDB Description: crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) in complex with elongation factor tu (ef-tu)
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d4iw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iw3a_ b.82.2.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
hpmlaavvddlathgwsqqahflpadlvralaaecrrrdaegelnpagvgrgatqevret
irgdqiqwidpgqaeacdqylaamdqlrlainqglflgledfechfalyppgafyrrhld
rfrdddrrmvsavlylnegwqphdggqlrmfladgvehdvepvagclvvflsgevphevl
pagrerlsltgwfrrrgndpf

SCOPe Domain Coordinates for d4iw3a_:

Click to download the PDB-style file with coordinates for d4iw3a_.
(The format of our PDB-style files is described here.)

Timeline for d4iw3a_: