Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (9 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [259652] (2 PDB entries) |
Domain d4iw3a_: 4iw3 A: [259653] Other proteins in same PDB: d4iw3b1, d4iw3b2, d4iw3b3, d4iw3k1, d4iw3k2, d4iw3k3 automated match to d4jzra_ complexed with gdp, mg, mn, oga |
PDB Entry: 4iw3 (more details), 2.7 Å
SCOPe Domain Sequences for d4iw3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iw3a_ b.82.2.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]} hpmlaavvddlathgwsqqahflpadlvralaaecrrrdaegelnpagvgrgatqevret irgdqiqwidpgqaeacdqylaamdqlrlainqglflgledfechfalyppgafyrrhld rfrdddrrmvsavlylnegwqphdggqlrmfladgvehdvepvagclvvflsgevphevl pagrerlsltgwfrrrgndpf
Timeline for d4iw3a_: