Class a: All alpha proteins [46456] (285 folds) |
Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) homotetramer |
Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
Protein automated matches [259190] (1 species) not a true protein |
Species Danio rerio [TaxId:7955] [259192] (2 PDB entries) |
Domain d4cz7c_: 4cz7 C: [259651] automated match to d3saka_ complexed with gol, po4 |
PDB Entry: 4cz7 (more details), 1.1 Å
SCOPe Domain Sequences for d4cz7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cz7c_ a.53.1.0 (C:) automated matches {Danio rerio [TaxId: 7955]} seeiftlqvrgreryeilkklndslelsdvv
Timeline for d4cz7c_: